PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C003121P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Dof
Protein Properties Length: 290aa    MW: 31804.2 Da    PI: 9.7616
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C003121P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.55.2e-3768126361
          zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                     e+alkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalr vPvGgg r+n+k+
  MELO3C003121P1  68 ETALKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRSVPVGGGYRRNNKR 126
                     6789************************************************9999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3351119IPR003851Zinc finger, Dof-type
PfamPF027011.5E-3170125IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.70571125IPR003851Zinc finger, Dof-type
PROSITE patternPS01361073109IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MVFPSIPSNY LDPTTHQWQQ QTATNHQSGS GTMIGGSSFQ LAPSPPPSQV RPGSMADRAR  60
MANLPVPETA LKCPRCESTN TKFCYFNNYS LSQPRHFCKT CRRYWTRGGA LRSVPVGGGY  120
RRNNKRTKSS SKSPVNSQCQ PTTTEPSAGE AMRLNYNNAI STPNEGAVDS THHHHHHHHP  180
IGISNFLGFD QIQWRPQLQL HQTTQPSSLV ANSARLLGNG GINSSLSYSI VGEIQKKMDA  240
TTTKMEEDGQ QVAEVNNVGK PFWGVVGGND NRHYWNGFNP SSSSSHSQV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818880.0LN681888.1 Cucumis melo genomic scaffold, anchoredscaffold00002.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008447721.10.0PREDICTED: dof zinc finger protein DOF5.1-like isoform X1
TrEMBLA0A0A0L2651e-180A0A0A0L265_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2477533
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.12e-43OBF-binding protein 3